Skip to content

Klarna & Clearpay Accepted

Fast Worldwide Shipping

24/7 Custommer Support

  • HOME
  • ALL PRODUCTSNEW
ElevateSupplements ElevateSupplementsElevateSupplements
  • BUNDLESNEW
0
0 / $0.00

Powders

Container of Elevate Creatine Monohydrate by ElevateSupplementsNI, showing micronized creatine powder in a clear jar.

Elevate Creatine Monohydrate | 100% Pure Micronised Creatine

$30.00 USD
Elevate Essential Amino Acids supplement container with colorful label showing EAAs and electrolytes for fitness recovery.

Elevate Essential Amino Acids | EAAs & Electrolytes

From $48.00 USD
Elevate Peak Hydration electrolytes and creatine powder container from ElevateSupplements, with a blue and white label and scoop inside.

Elevate Peak Hydration | Electrolytes & Creatine Powder

$39.00 USD
Container of Elevate L-Glutamine 100% Ultra Micronised supplement from ElevateSupplementsNI, showing the product packaging on a white background.

Elevate L-Glutamine | 100% Ultra Micronised

$30.00 USD
Elevate Whey Protein in Vanilla Ice Cream flavor, high protein supplement with a sleek tub and scoop of powder on a white background.

Elevate Whey Protein | High Protein Formula - Vanilla Ice Cream

$40.00 USD
Elevate Mushroom Coffee by ElevateSupplementsNI featuring lion's mane and adaptogenic mushrooms in a cup on a wooden table.

Elevate Mushroom Coffee | Lion's Mane & Adaptogenic Mushrooms

$24.00 USD
View All

Get in touch

Unit 26, Kilwee Business Park, Upper Dunmurry Ln, Belfast BT17 0HD

elevatesupplementsni@outlook.com

Policies

Policies

  • Privacy Policy
  • Refund / Returns Policy
  • Shipping Policy
  • Terms & Conditions

Useful links

Affiliate

  • Mentorship

Newsletter Signup

Newsletter Signup

Subscribe to our newsletter and get 10% off your first purchase

klarnaclearpayvisamasterpaypalapple paygoogle paymaestroamerican expressdiscover
Copyright © 2026 ElevateSupplemenetsNI all rights reserved.
  • Choosing a selection results in a full page refresh.